CATH Domain: 1qynD00 XML data for domain: 1qynD00

Molscript image for 1qynD00
1qynD00
PDB coordinates for domain 1qynD00

PDB 1qyn, Chain D, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.420 Bacterial Protein-export protein SecB
3.10.420.10 Gene3D
3.10.420.10.2
3.10.420.10.2.1
3.10.420.10.2.1.1
3.10.420.10.2.1.1.1
3.10.420.10.2.1.1.1.1

[top]
Segment boundaries for domain 1qynD00

Chopping figure for domain 1qynD00
DomainStart PDB ResidueStop PDB Residue
1qynD00 9 144

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.10.420.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1fx3D00 93.30 Protein exportBacterial secretion systemPreprotein translocase subunit SecBHaemophilus influenzaeProtein-export protein secB 3.10.420.10 135 57 97 1.04 1.06
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1qynD00
MTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSIAG
IEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1qynD00
MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQ
GGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQ
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:16

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"