CATH Domain: 1qx2A00 XML data for domain: 1qx2A00

Molscript image for 1qx2A00
1qx2A00
PDB coordinates for domain 1qx2A00

PDB 1qx2, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.238 Recoverin; domain 1
1.10.238.10 EF-hand Gene3D
1.10.238.10.20
1.10.238.10.20.1
1.10.238.10.20.1.1
1.10.238.10.20.1.1.1
1.10.238.10.20.1.1.1.1

[top]
Segment boundaries for domain 1qx2A00

Chopping figure for domain 1qx2A00
DomainStart PDB ResidueStop PDB Residue
1qx2A00 1 75

Structural Neighbourhood (26 entries)

There are 26 matching structural neighberhood comparisons for CATH ID 1.10.238.10.20.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 26 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1g33A00 89.54 Rattus norvegicusParvalbumin alpha 1.10.238.10 73 21 94 3.97 4.19
1ggzA01 88.07 Calcium ion bindingOlfactory transductionCalcium signaling pathwayPhosphatidylinositol signaling systemInsulin signaling pathway 1.10.238.10 76 33 93 4.51 4.83
1wrkA00 87.28 Cardiac muscle contractionCalcium signaling pathwayDilated cardiomyopathyHypertrophic cardiomyopathy (HCM)Calcium ion binding 1.10.238.10 82 41 86 3.51 4.05
2f3yA02 87.06 Phosphatidylinositol signaling systemCalcium signaling pathwayOocyte meiosisMelanogenesisInsulin signaling pathway 1.10.238.10 68 45 89 3.86 4.32
1qtxA02 86.86 1.10.238.10 68 44 89 3.94 4.41
1dtlA02 86.50 Cardiac muscle contractionCalcium signaling pathwayTroponin C, slow skeletal and cardiac musclesGallus gallusTroponin C, slow skeletal and cardiac muscles 1.10.238.10 63 33 84 3.61 4.30
1a4pA00 84.47 Protein S100-A10Homo sapiens 1.10.238.10 92 24 78 2.77 3.54
1tizA00 84.39 Calcium-binding protein CMLArabidopsis thalianaPlant-pathogen interactionProbable calcium-binding protein CML34 1.10.238.10 66 25 88 2.81 3.19
2bl0B01 84.29 Physarum polycephalumMyosin regulatory light chain 1.10.238.10 68 19 89 3.19 3.57
1jfjA01 84.21 Entamoeba histolyticaCalcium-binding protein 1.10.238.10 63 19 84 3.13 3.73
1fi5A00 83.37 Cardiac muscle contractionCalcium signaling pathwayTroponin C, slow skeletal and cardiac musclesGallus gallusTroponin C, slow skeletal and cardiac muscles 1.10.238.10 81 30 82 4.01 4.85
1qasA01 83.15 Calcium ion bindingPhosphatidylinositol signaling systemCalcium signaling pathwayRattus norvegicusElevation of cytosolic calcium ion concentration involved in G-protein signaling coupled to IP3 second messenger 1.10.238.10 88 20 81 3.83 4.68
1eg3A04 82.81 Cell surfaceCostamereCytoskeletonDystrophin-associated glycoprotein complexActin binding 1.10.238.10 82 13 84 3.62 4.30
1k90E01 81.27 Phosphatidylinositol signaling systemCalcium signaling pathwayOocyte meiosisMelanogenesisInsulin signaling pathway 1.10.238.10 74 35 94 3.58 3.78
1fi6A00 81.06 Mus musculusRalBP1-associated Eps domain-containing protein 1Protein binding 1.10.238.10 92 13 72 3.59 4.93
1jfjA02 80.24 Entamoeba histolyticaCalcium-binding protein 1.10.238.10 71 19 84 3.52 4.19
1c07A00 79.92 Plasma membraneClathrin coat assemblyEpidermal growth factor receptor substrate 15Homo sapiensEpidermal growth factor receptor signaling pathway 1.10.238.10 95 17 72 2.59 3.57
1djxB01 79.85 Calcium ion bindingCalcium signaling pathwayPhosphatidylinositol signaling systemRattus norvegicusElevation of cytosolic calcium ion concentration involved in G-protein signaling coupled to IP3 second messenger 1.10.238.10 52 21 69 3.04 4.38
1h8bA00 79.33 Alpha-actinin-2ZASP bindingNucleolusFATZ 1 bindingMicrospike assembly 1.10.238.10 73 12 80 3.53 4.41
1m45A02 78.08 Vesicle targetingIdentical protein bindingMyosin II heavy chain bindingProtein localizationVesicle 1.10.238.10 75 21 92 4.07 4.42
1s26D01 78.05 Calcium signaling pathwayPhosphatidylinositol signaling systemOocyte meiosisMelanogenesisInsulin signaling pathway 1.10.238.10 59 35 77 3.27 4.23
1ij5A03 75.95 Physarum polycephalumPlasmodial-specific protein LAV1-2 1.10.238.10 130 14 52 2.53 4.84
2avaA00 75.40 Spinacia oleraceaAcyl carrier protein 1, chloroplastic 1.10.1200.10 82 4 74 3.36 4.52
2cnrA00 75.10 Acyl carrier proteinAcyl carrier proteinStreptomyces coelicolor 1.10.1200.10 82 8 75 3.37 4.46
2jq4A00 73.53 Agrobacterium tumefaciens str. C58Acyl carrier protein, putative 1.10.1200.10 83 5 67 3.23 4.79
3ce7A00 70.72 ToxoplasmaSpecific mitochodrial acyl carrier protein 1.10.1200.10 84 8 70 3.50 4.98
[1]
Displaying entries 1 to 26 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1qx2A00
KSPEEIKGAFEVFAAKEGDPNQISKEELKLVMQTLGPSLLKGMSTLDEMIEEVDKNGDGEVSFEEFLVMMKKISQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1qx2A00
XKSPEEIKGAFEVFAAKEGDPNQISKEELKLVMQTLGPSLLKGMSTLDEMIEEVDKNGDGEVSFEEFLVMMKKISQ
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:32

Assigning to "1.10.238.10" based on similarity with "1kcyA00" (NWSI: 81.3333333333333, NWO: 98.6842105263158, SPS: 80.12, SPO: 89, RMSD: 4.12)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1qx2A00"

Flow stage update by auto on 28 Apr 2006 17:44

All required files are present for Domain "1qx2A00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1qx2A00"

Insertion by auto on 08 Mar 2006 23:27

Final ChopClose added based on similarity with "1qx2B" [LEE: 1, LME: 0, MR: 0, LG: 1, SS: 94.92, SI: 98.6842105263158, SO: 100]