CATH Domain: 1qu6A02 XML data for domain: 1qu6A02

Molscript image for 1qu6A02
1qu6A02
PDB coordinates for domain 1qu6A02

PDB 1qu6, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.160 Double Stranded RNA Binding Domain
3.30.160.20 Gene3D
3.30.160.20.9
3.30.160.20.9.1
3.30.160.20.9.1.1
3.30.160.20.9.1.1.1
3.30.160.20.9.1.1.1.1

[top]
Segment boundaries for domain 1qu6A02

Chopping figure for domain 1qu6A02
DomainStart PDB ResidueStop PDB Residue
1qu6A01 1 85
1qu6A02 104 179

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.160.20.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2rqlA00 79.62 Protein bindingPutative sigma-54 modulation proteinEscherichia coli K-12Probable sigma(54) modulation protein 3.30.160.100 95 5 74 3.23 4.32
1jpdX01 75.41 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 3 53 2.45 4.58
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1qu6A02
GNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETGSGC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1qu6A02
GNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETGSGC
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:01

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:01

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:38

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"