Set cath from cathlist by auto on 05 Mar 2006 19:36
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1qtqA01 | 347 | 464 |
| 1qtqA02 | 339 | 346 |
| 1qtqA02 | 465 | 546 |
| 1qtqA03 | 260 | 338 |
| 1qtqA04 | 100 | 208 |
| 1qtqA05 | 27 | 99 |
| 1qtqA05 | 210 | 259 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1qtqA04 SDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMA SPFIVMRDPVLYRIKFAEHHQTGNKWCIY
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"