CATH Domain: 1qtqA03 XML data for domain: 1qtqA03

Molscript image for 1qtqA03
1qtqA03
PDB coordinates for domain 1qtqA03

PDB 1qtq, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1160 Glutamyl-tRNA Synthetase; domain 2
1.10.1160.10 Glutamyl-trna Synthetase; Domain 2 Gene3D
1.10.1160.10.2
1.10.1160.10.2.1
1.10.1160.10.2.1.1
1.10.1160.10.2.1.1.1
1.10.1160.10.2.1.1.1.1

[top]
Segment boundaries for domain 1qtqA03

Chopping figure for domain 1qtqA03
DomainStart PDB ResidueStop PDB Residue
1qtqA01 347 464
1qtqA02 339 346
1qtqA02 465 546
1qtqA03 260 338
1qtqA04 100 208
1qtqA05 27 99
1qtqA05 210 259

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1qtqA03
RLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNEN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1qtqA03
RLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNEN
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:38

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"