Set cath from cathlist by auto on 05 Mar 2006 18:34
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1qtqA01 | 347 | 464 |
| 1qtqA02 | 339 | 346 |
| 1qtqA02 | 465 | 546 |
| 1qtqA03 | 260 | 338 |
| 1qtqA04 | 100 | 208 |
| 1qtqA05 | 27 | 99 |
| 1qtqA05 | 210 | 259 |
There are 1 matching structural neighberhood comparisons for CATH ID 2.40.240.10.2.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1feuA01 | 79.04 | 2.40.240.10 | 91 | 8 | 65 | 2.44 | 3.70 |
>pdb|1qtqA02 APRAMAVILPVEIRLYDRLFSVPNPGAADDFLSVINPESLVIKQGFAEPSLKDAVAGKAFQFEREGYFCLDSRHSTAEKP VFNRTVGLRD
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"