CATH Domain: 1qstA00 XML data for domain: 1qstA00

Molscript image for 1qstA00
1qstA00
PDB coordinates for domain 1qstA00

PDB 1qst, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.30 Gene3D
3.40.630.30.12
3.40.630.30.12.1
3.40.630.30.12.1.1
3.40.630.30.12.1.1.1
3.40.630.30.12.1.1.1.1

[top]
Segment boundaries for domain 1qstA00

Chopping figure for domain 1qstA00
DomainStart PDB ResidueStop PDB Residue
1qstA00 49 208

Structural Neighbourhood (35 entries)

There are 35 matching structural neighberhood comparisons for CATH ID 3.40.630.30.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 35 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2r7hB00 84.55 Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein 3.40.630.30 157 9 85 3.26 3.84
3k9uA00 84.34 Putative uncharacterized protein Ta0374Thermoplasma acidophilum 3.40.630.30 159 15 82 2.94 3.56
1cjwA00 84.23 Ovis ariesSerotonin N-acetyltransferase 3.40.630.30 166 13 81 2.86 3.49
3d8pB00 84.02 Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein 3.40.630.30 157 11 88 2.78 3.15
2ozgA01 83.84 Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase 3.40.630.30 117 17 71 2.21 3.07
2q7bA00 83.73 Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V 3.40.630.30 161 11 87 2.96 3.38
2i00C01 83.54 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 144 8 76 2.06 2.68
3g8wA00 83.25 Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05 3.40.630.30 158 10 82 3.01 3.65
3efaA00 83.23 Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation 3.40.630.30 141 7 85 3.70 4.35
1n71B00 83.09 Aac(6')-Ii proteinEnterococcus faecium 3.40.630.30 179 13 78 2.91 3.69
1q2yA00 83.08 Bacillus subtilisUncharacterized N-acetyltransferase yjcF 3.40.630.30 140 14 81 2.69 3.31
2fiaA00 82.90 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 157 12 83 2.87 3.43
1tiqB00 82.90 Bacillus subtilisProtease synthase and sporulation negative regulatory protein PAI 1 3.40.630.30 161 11 85 3.17 3.73
2ae6A00 82.42 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 144 15 78 3.76 4.81
1bo4A00 82.42 Aminoglycoside-(3)-N-acetyltransferaseSerratia marcescens 3.40.630.30 136 13 76 3.66 4.80
3exnA00 82.40 Tyrosine metabolismLimonene and pinene degradation1- and 2-Methylnaphthalene degradationPhenylalanine metabolismBenzoate degradation via CoA ligation 3.40.630.30 151 15 83 3.37 4.05
1qsmD00 81.50 CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2 3.40.630.30 152 13 82 4.09 4.96
3d3sA00 81.00 L-2,4-diaminobutyric acid acetyltransferaseGlycine, serine and threonine metabolismBordetella parapertussisL-2,4-diaminobutyric acid acetyltransferase [EC:2.3.1.178]Metabolic pathways 3.40.630.30 157 9 82 3.13 3.79
2pdoA01 80.97 Shigella flexneriAcetyltransferase ypeA 3.40.630.30 118 11 71 2.41 3.35
2pr1A00 80.52 Uncharacterized N-acetyltransferase ylbPBacillus subtilis 3.40.630.30 152 15 83 4.10 4.93
2dxqA00 80.52 Agrobacterium tumefaciens str. C58Acetyltransferase 3.40.630.30 145 10 80 4.00 4.96
1ro5A01 80.43 Pseudomonas aeruginosaAcyl homoserine lactone synthase [EC:2.3.1.184]Acyl-homoserine-lactone synthase 3.40.630.30 187 9 77 3.27 4.25
3eo4A00 80.32 Methanocaldococcus jannaschiiUncharacterized protein MJ1062 3.40.630.30 155 9 81 3.27 3.99
2r1iA01 79.41 Arthrobacter sp. FB24GCN5-related N-acetyltransferase 3.40.630.30 129 10 71 3.22 4.48
3f5bA00 79.02 Aminoglycoside N(6')acetyltransferaseLegionella pneumophila subsp. pneumophila str. Philadelphia 1 3.40.630.30 163 7 84 3.81 4.53
1bobA02 79.01 Chromatin silencing at telomereHistone acetyltransferase 1 [EC:2.3.1.48]Histone acetyltransferase type B catalytic subunitHistone acetyltransferase activityProtein binding 3.40.630.30 124 8 61 2.18 3.52
2fl4A02 78.77 Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis 3.40.630.30 104 17 61 2.79 4.51
2hqyA02 78.66 Hypothetical proteinBacteroides thetaiotaomicronPutative uncharacterized protein 3.40.630.30 164 5 70 2.81 3.97
2ozhA01 78.39 Xanthomonas campestris pv. campestrisPutative uncharacterized protein 3.40.630.30 120 9 71 3.26 4.54
2q0yA01 78.16 Ralstonia eutropha JMP134GCN5-related N-acetyltransferase 3.40.630.30 125 10 68 2.93 4.30
1y7rA00 78.01 Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein 3.40.630.30 125 12 75 3.56 4.71
1sqhA02 77.78 Drosophila melanogasterCG14615 3.40.630.30 128 11 66 2.57 3.84
3gkrA02 77.23 Weissella viridescensFemX 3.40.630.30 165 5 71 2.74 3.83
1rxtC01 76.55 Glycylpeptide N-tetradecanoyltransferase [EC:2.3.1.97]Protein lipoylationHomo sapiensGlycylpeptide N-tetradecanoyltransferase 1 3.40.630.30 132 9 71 3.39 4.76
3dsbA01 76.05 Putative acetyltransferaseClostridium difficile 630 3.40.630.30 96 12 51 2.32 4.47
[1]
Displaying entries 1 to 35 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1qstA00
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAV
TANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1qstA00
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAV
TANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDY
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:49

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"