CATH Domain: 1qssA01 XML data for domain: 1qssA01

Molscript image for 1qssA01
1qssA01
PDB coordinates for domain 1qssA01

PDB 1qss, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.10 Gene3D
3.30.420.10.12
3.30.420.10.12.1
3.30.420.10.12.1.1
3.30.420.10.12.1.1.1
3.30.420.10.12.1.1.1.1

[top]
Segment boundaries for domain 1qssA01

Chopping figure for domain 1qssA01
DomainStart PDB ResidueStop PDB Residue
1qssA01 293 446
1qssA02 447 563
1qssA03 564 613
1qssA03 758 831
1qssA04 614 757

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.420.10.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2kfnA01 80.61 Pyrimidine metabolismDNA replicationNucleotide excision repairPurine metabolismMetabolic pathways 3.30.420.10 217 20 70 3.13 4.41
2p1jA01 72.42 Thermotoga maritimaPyrimidine metabolismDNA replicationPurine metabolismMetabolic pathways 3.30.420.10 138 9 61 3.00 4.91
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1qssA01
ALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEERGLLAKDLSVLALREGLGLPPGDD
PMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1qssA01
ALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEERGLLAKDLSVLALREGLGLPPGDD
PMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:38

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"