CATH Domain: 1qrvA00 XML data for domain: 1qrvA00

Molscript image for 1qrvA00
1qrvA00
PDB coordinates for domain 1qrvA00

PDB 1qrv, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.30 DNA Binding (I), subunit A
1.10.30.10 DNA Binding (I), subunit A Gene3D
1.10.30.10.2
1.10.30.10.2.1
1.10.30.10.2.1.1
1.10.30.10.2.1.1.1
1.10.30.10.2.1.1.1.1

[top]
Segment boundaries for domain 1qrvA00

Chopping figure for domain 1qrvA00
DomainStart PDB ResidueStop PDB Residue
1qrvA00 2 74

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 1.10.30.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1cktA00 88.68 Base excision repairGlycolipid bindingResponse to heatRAGE receptor bindingPositive regulation of neuron projection development 1.10.30.10 71 26 91 2.14 2.33
1gt0D00 87.99 Tongue developmentEpithelial tube branching involved in lung morphogenesisNegative regulation of Wnt receptor signaling pathwayPigment biosynthetic processNegative regulation of transcription from RNA polymerase II promoter 1.10.30.10 79 24 91 4.18 4.59
1hsmA00 85.02 Cricetulus griseusHigh mobility group protein B1 1.10.30.10 79 41 91 2.12 2.33
2lefA00 84.39 Odontogenesis of dentine-containing toothLymphoid enhancer-binding factor 1Paraxial mesoderm formationRegulation of Wnt receptor signaling pathwayBMP signaling pathway 1.10.30.10 86 19 83 3.96 4.73
1k99A00 81.29 Homo sapiensNucleolar transcription factor 1RNA polymerase I transcription factor activityProtein binding 1.10.30.10 91 15 76 3.10 4.03
1l8yA00 78.64 Homo sapiensNucleolar transcription factor 1Protein bindingRNA polymerase I transcription factor activity 1.10.30.10 83 24 86 3.50 4.03
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1qrvA00
SDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKEFEANG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1qrvA00
SDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKEFEANG
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:24

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"