CATH Domain: 1qnaA02 XML data for domain: 1qnaA02

Molscript image for 1qnaA02
1qnaA02
PDB coordinates for domain 1qnaA02

PDB 1qna, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.310 TATA-Binding Protein
3.30.310.10 TATA-Binding Protein Gene3D
3.30.310.10.2
3.30.310.10.2.1
3.30.310.10.2.1.1
3.30.310.10.2.1.1.1
3.30.310.10.2.1.1.1.1

[top]
Segment boundaries for domain 1qnaA02

Chopping figure for domain 1qnaA02
DomainStart PDB ResidueStop PDB Residue
1qnaA01 19 29
1qnaA01 116 197
1qnaA02 30 115

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.30.310.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2z8uB02 92.48 Methanocaldococcus jannaschiiTATA-box-binding proteinTranscription initiation factor TFIID TATA-box-binding proteinBasal transcription factors 3.30.310.10 87 33 98 1.58 1.60
1harA02 80.12 Human immunodeficiency virus type 1 BH10Gag-Pol polyprotein 3.30.70.270 69 2 76 2.84 3.70
1dloB02 78.56 Human immunodeficiency virus type 1 BH10Gag-Pol polyprotein 3.30.70.270 93 5 78 3.03 3.86
2g30A02 78.46 AP-2 complex subunit betaHomo sapiensProtein binding 3.30.310.10 116 6 62 2.76 4.39
1lwcB02 78.39 HIV-1 M:B_HXB2RGag-Pol polyprotein 3.30.70.270 87 8 81 3.01 3.69
1s1tA02 78.26 HIV-1 M:B_HXB2RGag-Pol polyprotein 3.30.70.270 93 6 78 3.07 3.91
1p5dX04 78.22 Galactose metabolismAmino sugar and nucleotide sugar metabolismFructose and mannose metabolismMetabolic pathwaysStarch and sucrose metabolism 3.30.310.50 93 10 81 3.98 4.87
1in0A01 77.96 Hypothetical proteinHaemophilus influenzaeUPF0234 protein HI_1034 3.30.70.860 70 12 74 3.51 4.72
1m5q102 77.44 Pyrobaculum aerophilumSmall nuclear ribonucleoprotein homolog (Sm-like) 3.30.310.60 56 16 59 2.84 4.79
1kyfA02 75.89 Mus musculusStored secretory granuleAP-2 complex subunit alpha-2Intracellular protein transport 3.30.310.30 113 3 62 3.06 4.87
1ul7A00 74.79 Mus musculusMAP/microtubule affinity-regulating kinase 3 3.30.310.80 102 6 69 3.11 4.47
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1qnaA02
STVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAK
FKDFKI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1qnaA02
STVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAK
FKDFKI
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:37

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"