Set cath from cathlist by auto on 05 Mar 2006 18:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1qh4A01 | 6 | 102 |
| 1qh4A02 | 105 | 381 |
There are 1 matching structural neighberhood comparisons for CATH ID 1.10.135.10.2.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
3l2fR01 | 91.88 | 1.10.135.10 | 102 | 50 | 94 | 2.02 | 2.15 |
>pdb|1qh4A01 SHNLLKMKYSVDDEYPDLSVHNNHMAKVLTLDLYKKLRDRQTSSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVF KELFDPVIEDRHGGYKP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"