Set cath from cathlist by auto on 05 Mar 2006 19:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
CATH Domain: 1qgiA01
1qgiA01
PDB 1qgi, Chain A, Domain 1
Segment boundaries for domain 1qgiA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1qgiA01 | 1 | 147 |
| 1qgiA02 | 148 | 258 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.386.10.1.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1chkA02 | 78.98 | 3.30.386.10 | 95 | 24 | 64 | 3.21 | 4.97 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|1qgiA01 ASPDDNFSPETLQFLRNNTGLDGEQWNNIMKLINKPEQDDLNWIKYYGYCEDIEDERGYTIGLFGATTGGSRDTHPDGPD LFKAYDAAKGASNPSADGALKRLGINGKMKGSILEIKDSEKVFCGKIKKLQNDAAWRKAMWETFYNV
Domain History Events (3)
Flow stage update by auto on 05 Mar 2006 19:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
Insertion by auto on 05 Mar 2006 17:36
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
