Set cath from cathlist by auto on 05 Mar 2006 19:12
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1qamA01 | 10 | 134 |
| 1qamA01 | 149 | 180 |
| 1qamA02 | 135 | 148 |
| 1qamA02 | 181 | 244 |
There are 20 matching structural neighberhood comparisons for CATH ID 3.40.50.150.84.1.1.1.1 (SIMAX score < 5)
>pdb|1qamA01 QNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEIDHKLCKTTENKLVDHDNFQVLNKDILQFK FPKNQSYKIFGNIPYNISTDIIRKIVFDSIADEIYLIVEYGFAKREVDISILSMVPREYFHPKPKVNSSLIRLNRKK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"