CATH Domain: 1qadA00 XML data for domain: 1qadA00

Molscript image for 1qadA00
1qadA00
PDB coordinates for domain 1qadA00

PDB 1qad, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.9
3.30.505.10.9.1
3.30.505.10.9.1.1
3.30.505.10.9.1.1.1
3.30.505.10.9.1.1.1.1

[top]
Segment boundaries for domain 1qadA00

Chopping figure for domain 1qadA00
DomainStart PDB ResidueStop PDB Residue
1qadA00 1 107

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 3.30.505.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2crhA01 90.06 Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis 3.30.505.10 102 34 94 2.88 3.06
2iugA00 89.45 ErbB-3 class receptor bindingInsulin-like growth factor receptor signaling pathwayInsulin receptor signaling pathwayGrowth hormone receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 110 34 92 3.72 4.01
2oq1A03 87.64 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 99 25 89 2.07 2.31
2shpA02 86.98 Tyrosine-protein phosphatase non-receptor type 11Homo sapiens 3.30.505.10 101 27 87 2.01 2.30
2oq1A01 86.78 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 108 24 87 3.26 3.71
1ayaA00 86.60 Hormone-mediated signaling pathwayRegulation of multicellular organism growthNerve growth factor receptor signaling pathwayTriglyceride metabolic processNegative regulation of insulin secretion 3.30.505.10 101 27 91 2.18 2.39
1milA00 86.07 Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 104 23 92 3.81 4.13
1i3zA00 85.46 Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding 3.30.505.10 102 24 88 2.56 2.89
2dm0A01 85.22 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 31 82 1.99 2.41
3bkbA01 84.87 Tyrosine-protein kinase Fes/FpsHomo sapiensCell proliferationMulticellular organismal development 3.30.505.10 93 27 83 2.75 3.29
1ju5A00 83.82 Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway 3.30.505.10 109 28 79 2.09 2.62
2kk6A00 83.44 CytoplasmFer (fps/fes related) tyrosine kinase [EC:2.7.10.2]Homo sapiensAdherens junctionTyrosine-protein kinase Fer 3.30.505.10 116 30 83 3.21 3.84
2pldA00 82.23 Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway 3.30.505.10 105 28 92 4.51 4.88
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1qadA00
EDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVL
HYQHTSLVQHNDSLNVTLAYPVYA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1qadA00
EDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKE
LVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:30

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"