CATH Domain: 1q6hA02 XML data for domain: 1q6hA02

Molscript image for 1q6hA02
1q6hA02
PDB coordinates for domain 1q6hA02

PDB 1q6h, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.50 Chitinase A; domain 3
3.10.50.40 Gene3D
3.10.50.40.5
3.10.50.40.5.1
3.10.50.40.5.1.1
3.10.50.40.5.1.1.1
3.10.50.40.5.1.1.1.1

[top]
Segment boundaries for domain 1q6hA02

Chopping figure for domain 1q6hA02
DomainStart PDB ResidueStop PDB Residue
1q6hA01 15 121
1q6hA02 122 224

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.10.50.40.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3b7xA00 88.05 Homo sapiensPeptidyl-prolyl cis-trans isomerase FKBP6FK506 bindingProtein folding 3.10.50.40 117 31 82 1.62 1.97
1jvwA00 85.02 Macrophage infectivity potentiatorTrypanosoma cruzi 3.10.50.40 160 48 64 0.99 1.54
1hxvA00 79.65 Trigger factorTrigger factorMycoplasma genitalium 3.10.50.40 85 17 79 2.63 3.30
1m5yA03 78.27 Chaperone surAChaperone mediated protein folding requiring cofactorMaintenance of stationary phasePeptidyl-prolyl cis-trans isomerase activityBiofilm formation 3.10.50.40 107 13 66 3.23 4.87
1okgA03 76.17 3-mercaptopyruvate sulfurtransferase [EC:2.8.1.2]Cysteine and methionine metabolismMercaptopyruvate sulfurtransferaseLeishmania majorMetabolic pathways 3.30.1670.10 66 7 58 2.73 4.69
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1q6hA02
GLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYG
KAGVPGIPPNSTLVFDVELLDVK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1q6hA02
GLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYG
KAGVPGIPPNSTLVFDVELLDVK
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 15 Aug 2007 01:45

Assigning to "3.10.50.40" based on similarity with "1q6hB02"

Flow stage update by auto on 15 Aug 2007 01:20

No in_process hits for Domain "1q6hA02" ready to be processed

Update comment by auto on 14 Aug 2007 23:54

Domain "1q6hA02" hits Domain "1q6iA02" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:45

Domain "1q6hA02" hits Domain "1q6iB02" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Jul 2007 18:50

Domain "1q6hA02" hits Domain "1q6hB02" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Jul 2007 18:50

NW result present for Domain "1q6hA02"

Flow stage update by auto on 14 Jul 2007 06:01

All required files are present for Domain "1q6hA02"

Flow stage update by auto on 13 Jul 2007 18:42

Beginning processing for Domain "1q6hA02"

Insertion by auto on 12 Jul 2007 22:19

Final ChopClose added based on similarity with "1fd9A"