Set cath from cathlist by auto on 05 Mar 2006 18:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1q5nA01 | 7 | 105 |
| 1q5nA02 | 106 | 361 |
| 1q5nA03 | 363 | 443 |
There are 2 matching structural neighberhood comparisons for CATH ID 1.10.40.30.8.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1jswB03 | 80.39 | 1.10.40.30 | 50 | 16 | 61 | 1.85 | 3.00 | |
![]() |
1j3uA03 | 80.31 | 1.10.40.30 | 52 | 13 | 64 | 1.85 | 2.88 |
>pdb|1q5nA03 THGLIMAEAVMMALAPHMGRLNAHHVVEAACKTAVAEQKHLKDIISQVDEVKQYFNPSQLDEIFKPESYLGNIQDQIDAV L
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"