Set cath from cathlist by auto on 05 Mar 2006 18:07
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1q5nA01 | 7 | 105 |
| 1q5nA02 | 106 | 361 |
| 1q5nA03 | 363 | 443 |
There are 1 matching structural neighberhood comparisons for CATH ID 1.10.275.10.9.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1dofA02 | 86.84 | 1.10.275.10 | 85 | 21 | 79 | 2.07 | 2.59 |
>pdb|1q5nA01 SLFYQRDVTEIFSDRALVSYMVEAEVALAQAQAQVGVIPQSAATVIQRAAKTAIDKIDFDALATATGLAGNIAIPFVKQL TAIVKDADEDAARYVHWGA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"