CATH Domain: 1q06A00 XML data for domain: 1q06A00

Molscript image for 1q06A00
1q06A00
PDB coordinates for domain 1q06A00

PDB 1q06, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1660 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2
1.10.1660.10 Gene3D
1.10.1660.10.2
1.10.1660.10.2.1
1.10.1660.10.2.1.1
1.10.1660.10.2.1.1.1
1.10.1660.10.2.1.1.1.1

[top]
Segment boundaries for domain 1q06A00

Chopping figure for domain 1q06A00
DomainStart PDB ResidueStop PDB Residue
1q06A00 1 127

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.1660.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1r8eA02 79.69 Multidrug-efflux transporter 1 regulatorBacillus subtilis 1.10.1660.10 73 28 56 2.03 3.59
2p7jB01 71.54 Vibrio parahaemolyticusPutative sensory box/GGDEF family protein 1.20.5.170 39 12 31 1.16 3.63
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1q06A00
MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNLEESGELVNLFNDPQRHSADV
KRRTLEKVAEIERHIEELQSMRDQLLALANACPGCPIIENLS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1q06A00
MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNLEESGELVNLFNDPQRHSADV
KRRTLEKVAEIERHIEELQSMRDQLLALANACPGDDSADCPIIENLSGCCHHRAG
BLAST against CATH

[top]
Domain History Events (5)

Domain move by cuff on 26 Apr 2006 15:19

COMMENT: Lesley - Yes, merge. Excellent scores and superpositions. Problems with domain chopping have been identified from version 2.6. The two classifications need to be reviewed and fixed in version 3.1. FINAL: Lesley - Yes, merge. Move sequence family of the following: 1q08A00, 1q06A00 to 1.10.1660.10 IAW SCOP.

Flow stage update by cuff on 26 Apr 2006 15:19

COMMENT: Lesley - Yes, merge. Excellent scores and superpositions. Problems with domain chopping have been identified from version 2.6. The two classifications need to be reviewed and fixed in version 3.1. FINAL: Lesley - Yes, merge. Move sequence family of the following: 1q08A00, 1q06A00 to 1.10.1660.10 IAW SCOP.

Set cath from cathlist by auto on 05 Mar 2006 18:02

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:02

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"