CATH Domain: 1pyiA01 XML data for domain: 1pyiA01

Molscript image for 1pyiA01
1pyiA01
PDB coordinates for domain 1pyiA01

PDB 1pyi, Chain A, Domain 1

This domain is in the HOMCHECK_REVIEW flow stage and therefore has not yet been assigned to a homologous superfamily in CATH. You can view the domain history to see more information.

[top]
Segment boundaries for domain 1pyiA01

Chopping figure for domain 1pyiA01
DomainStart PDB ResidueStop PDB Residue
1pyiA01 34 95

Structural Neighbourhood ( entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1pyiA01
CKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSYVFFLEDRLAVMMRVLKEYG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1pyiA01
CKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSYVFFLEDRLAVMMRVLKEYG
BLAST against CATH

[top]
Domain History Events (40)

Homcheck comment by cuff on 06 Jul 2010 13:30

chopping issue

Domain assignment manual match t by tronnberg on 10 Dec 2007 16:26

SSAP: 81.1 OV: 56 SEQ: 31. Different function.

Homcheck review by tronnberg on 10 Dec 2007 16:26

SSAP: 81.1 OV: 56 SEQ: 31. Different function.

Flow stage update by tronnberg on 10 Dec 2007 16:26

SSAP: 81.1 OV: 56 SEQ: 31. Different function.

Homcheck allotment by tronnberg on 10 Dec 2007 16:23

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 10 Dec 2007 16:23

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Dec 2007 15:10

Calculated SCOP results for 1pyiA01 and inserted them into the database.

Domain scan scop cath by auto on 09 Dec 2007 15:10

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 5 results for 1pyiA01

Flow stage update by auto on 07 Dec 2007 15:09

Retrieved PRC_PFAMCATH results for job ID SID5089507722577968 and results inserted.

Domain scan prc pfamcath by auto on 07 Dec 2007 15:08

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 5 results for 1pyiA01

Update comment by auto on 06 Dec 2007 19:10

PRC_PFAMCATH job SID5089507722577968 is not yet finished.

Prc pfamcath submit by auto on 06 Dec 2007 19:06

The entry "1pyiA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Dec 2007 19:06

The entry "1pyiA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Dec 2007 19:01

Retrieved SSAP results for job ID SID9345192439252336 and results inserted.

Domain scan ssap cath by auto on 06 Dec 2007 18:59

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1773 results for 1pyiA01

Update comment by auto on 05 Dec 2007 19:09

SSAP job SID9345192439252336 is not yet finished.

Ssap cath submit by auto on 05 Dec 2007 19:05

The entry "1pyiA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 19:05

The entry "1pyiA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 18:59

Retrieved PRC results for job ID SID9572208745760048 and inserted them into the database.

Domain scan prc cath by auto on 05 Dec 2007 18:59

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 1pyiA01

Prc cath submit by auto on 05 Dec 2007 18:43

The entry "1pyiA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 18:43

The entry "1pyiA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 18:38

Retrieved HMM(SAM) results for job ID SID4881810620803568 and inserted them into the database.

Domain scan sam cath by auto on 05 Dec 2007 18:38

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 1pyiA01

Update comment by auto on 05 Dec 2007 14:54

HMM(SAM) job SID4881810620803568 is not yet finished.

Flow stage update by auto on 05 Dec 2007 14:40

The entry "1pyiA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 05 Dec 2007 14:40

The entry "1pyiA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 14:36

Retrieved "1pyiA01" CATHEDRAL results for job ID SID6887736146422048 and inserted them into the database.

Domain scan cathedral cath by auto on 05 Dec 2007 14:36

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 145 results for 1pyiA01

Update comment by auto on 05 Dec 2007 10:52

"1pyiA01" CATHEDRAL job SID6887736146422048 is not yet finished.

Cathedral cath submit by auto on 05 Dec 2007 10:29

The entry "1pyiA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 10:29

The entry "1pyiA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 10:28

ScanList with 11650 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1pyiA01.scanlist" for "1pyiA01"

Write scan list by auto on 05 Dec 2007 10:28

Writing ScanList containing 11650 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1pyiA01.scanlist" for domain "1pyiA01"

Flow stage update by auto on 24 Aug 2007 18:17

No satisfactory AssignClose result found.

Flow stage update by auto on 24 Aug 2007 18:10

No in_process hits for Domain "1pyiA01" ready to be processed

Flow stage update by auto on 24 Aug 2007 18:10

NW result present for Domain "1pyiA01"

Flow stage update by auto on 22 Aug 2007 10:07

All required files are present for Domain "1pyiA01"

Flow stage update by auto on 21 Aug 2007 17:49

Beginning processing for Domain "1pyiA01"

Insertion by cuff on 21 Aug 2007 12:51

nice chopping