Set cath from cathlist by auto on 05 Mar 2006 19:22
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1pszA01 | 24 | 178 |
| 1pszA02 | 179 | 309 |
There are 3 matching structural neighberhood comparisons for CATH ID 3.40.50.1980.13.1.2.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2o1eB01 | 88.48 | 3.40.50.1980 | 146 | 33 | 87 | 2.31 | 2.65 | |
![]() |
1pq4A01 | 88.25 | 3.40.50.1980 | 152 | 26 | 90 | 1.85 | 2.04 | |
![]() |
3gi1B01 | 87.05 | 3.40.50.1980 | 144 | 28 | 85 | 2.66 | 3.10 |
>pdb|1pszA01 KKDTTSGQKLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKL VENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTD
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"