Set cath from cathlist by auto on 05 Mar 2006 19:22
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1pswA01 | 2 | 151 |
| 1pswA02 | 163 | 348 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.2000.14.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1kjnA00 | 76.05 | 3.40.50.10160 | 148 | 8 | 77 | 3.37 | 4.38 |
>pdb|1pswA02 SEGEKSYTCNQFSLSSERPIGFCPGAEFGPAKRWPHYHYAELAKQLIDEGYQVVLFGSAKDHEAGNEILAALNTEQQAWC RNLAGETQLDQAVILIAACKAIVTNDSGLHVAAALNRPLVALYGPSSPDFTPPLSHKARVIRLITGEGYHQSLIDITPQR VLEELNALLLQEEA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"