CATH Domain: 1pnrA03 XML data for domain: 1pnrA03

Molscript image for 1pnrA03
1pnrA03
PDB coordinates for domain 1pnrA03

PDB 1pnr, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.2300 Gene3D
3.40.50.2300.42
3.40.50.2300.42.2
3.40.50.2300.42.2.1
3.40.50.2300.42.2.1.1
3.40.50.2300.42.2.1.1.10

[top]
Segment boundaries for domain 1pnrA03

Chopping figure for domain 1pnrA03
DomainStart PDB ResidueStop PDB Residue
1pnrA01 3 59
1pnrA02 60 161
1pnrA02 292 323
1pnrA03 162 291
1pnrA03 324 340

Structural Neighbourhood (32 entries)

There are 32 matching structural neighberhood comparisons for CATH ID 3.40.50.2300.42.2.1.1.10 (SIMAX score < 5)

[1]
Displaying entries 1 to 32 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2fepA02 91.31 Bacillus subtilisCatabolite control protein ALacI family transcriptional regulator 3.40.50.2300 140 23 93 1.35 1.44
3cs3A02 91.10 Sugar-binding transcriptional regulator, LacI familyLacI family transcriptional regulatorEnterococcus faecalis 3.40.50.2300 135 26 94 1.46 1.55
3bblA02 89.95 Chloroflexus aggregans DSM 9485LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupGTranscriptional regulator, LacI family 3.40.50.2300 137 26 93 1.63 1.74
3d8uA02 88.99 Putative transcriptional regulatorVibrio parahaemolyticusLacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor 3.40.50.2300 144 21 90 1.48 1.64
2qu7A02 88.93 Putative transcriptional regulatorStaphylococcus saprophyticus subsp. saprophyticus ATCC 15305 3.40.50.2300 137 18 94 1.94 2.04
1bykA02 87.79 Specific transcriptional repressor activityLacI family transcriptional regulator, trehalose operon repressorSequence-specific DNA binding transcription factor activityTranscriptionHTH-type transcriptional regulator treR 3.40.50.2300 117 17 85 1.65 1.92
3bilA02 87.21 Corynebacterium glutamicumPROBABLE LACI-FAMILY TRANSCRIPTIONAL REGULATOR 3.40.50.2300 136 21 94 1.99 2.11
2rjoA02 82.79 Burkholderia phytofirmans PsJNPeriplasmic binding protein/LacI transcriptional regulator 3.40.50.2300 168 18 76 2.53 3.32
2fepA01 80.87 Bacillus subtilisCatabolite control protein ALacI family transcriptional regulator 3.40.50.2300 133 10 76 3.33 4.33
2iksB02 80.74 LacI family transcriptional regulator, fructose operon transcriptional repressorFructose repressorEscherichia coli K-12 3.40.50.2300 173 13 74 2.63 3.53
3bilA01 80.01 Corynebacterium glutamicumPROBABLE LACI-FAMILY TRANSCRIPTIONAL REGULATOR 3.40.50.2300 120 7 74 2.95 3.95
2hqbA02 79.15 Transcriptional activator of comK geneTranscriptional activator of comK geneBacillus halodurans 3.40.50.2300 148 13 77 3.37 4.34
1ewkB02 78.92 Rattus norvegicusMembrane depolarizationElevation of cytosolic calcium ion concentration involved in G-protein signaling coupled to IP3 second messengerActivation of phospholipase C activity by metabotropic glutamate receptor signaling pathwayPostsynaptic density 3.40.50.2300 172 12 73 3.09 4.22
1dbqA01 78.53 LacI family transcriptional regulator, purine nucleotide synthesis repressorHTH-type transcriptional repressor purREscherichia coli K-12 3.40.50.2300 134 9 76 3.57 4.69
2hqbA01 78.49 Transcriptional activator of comK geneTranscriptional activator of comK geneBacillus halodurans 3.40.50.2300 130 10 73 3.43 4.64
3d8uB01 78.08 Putative transcriptional regulatorVibrio parahaemolyticusLacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor 3.40.50.2300 119 15 76 3.70 4.86
3clkB01 78.02 Lactobacillus plantarumTranscription regulator 3.40.50.2300 119 11 64 2.82 4.34
1ny5A01 77.89 Transcriptional regulator (NtrC family)Two-component system, NtrC family, response regulatorAquifex aeolicus 3.40.50.2300 136 11 69 2.96 4.24
2wjwA02 77.74 Glutamate receptor 2Alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activitySynaptic transmissionKainate selective glutamate receptor activityHomo sapiens 3.40.50.2300 163 8 76 3.54 4.65
1a04A01 77.01 Two-component systemTwo-component system, NarL family, nitrate/nitrite response regulator NarLProtein bindingEscherichia coli K-12Nitrate/nitrite response regulator protein narL 3.40.50.2300 124 5 73 3.62 4.90
1peaA02 76.17 ABC transportersAliphatic amidase expression-regulating proteinPseudomonas aeruginosaBranched-chain amino acid transport system substrate-binding protein 3.40.50.2300 176 10 72 3.27 4.53
2rjnA00 76.08 Response regulator receiver:Metal-dependent phosphohydrolase, HD subdomainNeptuniibacter caesariensis 3.40.50.2300 135 5 73 3.64 4.96
3gt7A00 75.50 Sensor proteinSyntrophus aciditrophicus SB 3.40.50.2300 131 5 72 3.08 4.25
1jdpA01 75.35 Homo sapiensNatriuretic peptide receptor activityAtrial natriuretic peptide receptor 3 3.40.50.2300 179 14 70 3.31 4.67
2qr3A00 75.22 Bacteroides fragilisTwo-component system response regulator 3.40.50.2300 119 10 71 3.15 4.40
3cnbA00 75.16 DNA-binding response regulator, merR familyColwellia psychrerythraea 34H 3.40.50.2300 124 10 72 3.17 4.38
2qzjA00 75.04 Two-component response regulatorClostridium difficile 630 3.40.50.2300 119 9 70 3.43 4.89
3bblA01 74.88 Chloroflexus aggregans DSM 9485LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupGTranscriptional regulator, LacI family 3.40.50.2300 136 3 72 3.62 4.97
1zgzA00 74.70 Two-component systemTorCAD operon transcriptional regulatory protein torRTwo-component system, OmpR family, torCAD operon response regulator TorRProtein bindingEscherichia coli K-12 3.40.50.2300 118 8 69 3.17 4.57
3b2nA00 74.51 Similar to two-component response regulatorStaphylococcus aureus subsp. aureus Mu50 3.40.50.2300 119 9 72 3.26 4.50
2qsjB00 74.17 DNA-binding response regulator, LuxR familyRuegeria pomeroyi 3.40.50.2300 122 7 70 3.26 4.60
3cz5B00 73.24 Two-component response regulator, LuxR familyAurantimonas manganoxydans SI85-9A1 3.40.50.2300 140 9 70 2.93 4.14
[1]
Displaying entries 1 to 32 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1pnrA03
AFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPT
AVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHRLIERRSVADGPFRDYR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1pnrA03
AFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPT
AVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHRLIERRSVADGPFRDYRR
BLAST against CATH

[top]
Domain History Events (5)

Classification merge by cuff on 25 Apr 2006 18:57

COMMENT: Adam - High SSAP scores, low evalues, high overlaps, high sequence ids. 13 S families in each superfamily, ~100 hits, presumably all members related. FINAL: lesley - yes, merge these H-level. excellent scores and superposition.

Flow stage update by cuff on 25 Apr 2006 18:57

COMMENT: Adam - High SSAP scores, low evalues, high overlaps, high sequence ids. 13 S families in each superfamily, ~100 hits, presumably all members related. FINAL: lesley - yes, merge these H-level. excellent scores and superposition.

Set cath from cathlist by auto on 05 Mar 2006 19:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:32

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"