CATH Domain: 1pn5A00 XML data for domain: 1pn5A00

Molscript image for 1pn5A00
1pn5A00
PDB coordinates for domain 1pn5A00

PDB 1pn5, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.533 Death Domain, Fas
1.10.533.10 Death Domain, Fas Gene3D
1.10.533.10.8
1.10.533.10.8.1
1.10.533.10.8.1.1
1.10.533.10.8.1.1.1
1.10.533.10.8.1.1.1.1

[top]
Segment boundaries for domain 1pn5A00

Chopping figure for domain 1pn5A00
DomainStart PDB ResidueStop PDB Residue
1pn5A00 59 151

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.533.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ucpA00 83.09 Protein homodimerization activityApoptosis-associated speck-like protein containing a CARDPositive regulation of interleukin-1 beta secretionPyrin domain bindingTumor necrosis factor-mediated signaling pathway 1.10.533.10 91 24 97 4.28 4.37
1a1wA00 79.35 FAS (TNFRSF6)-associated via death domainIdentical protein bindingPathways in cancerChagas diseaseAlzheimer's disease 1.10.533.10 83 15 87 3.44 3.95
1ichA00 79.13 Integral to plasma membraneChagas diseaseTumor necrosis factor receptor superfamily member 1AAlzheimer's diseasePositive regulation of I-kappaB kinase/NF-kappaB cascade 1.10.533.10 87 11 80 2.75 3.41
1ngrA00 79.11 Negative regulation of muscle organ developmentRattus norvegicusNucleusNeurotrophin signaling pathwayTumor necrosis factor receptor superfamily member 16 1.10.533.10 85 8 83 3.87 4.61
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1pn5A00
MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQYGEQRAWDLALHTWEQMGLR
SLCAQAQEGAGHS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1pn5A00
MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQYGEQRAWDLALHTWEQMGLR
SLCAQAQEGAGHSLEHHHHHH
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:33

Cut based on decision in database "DomChop" on "cathdb"