Resources »

CATH Domain: 1pn0A02

Molscript image for 1pn0A02

1pn0A02

PDB coordinates for domain 1pn0A02

PDB 1pn0, Chain A, Domain 2

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.9	D-Amino Acid Oxidase; Chain A, domain 2
3.30.9.10	D-Amino Acid Oxidase, subunit A, domain 2	Gene3D
3.30.9.10.5
3.30.9.10.5.1
3.30.9.10.5.1.1
3.30.9.10.5.1.1.1
3.30.9.10.5.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 1pn0A02

Chopping figure for domain 1pn0A02

Domain	Start PDB Residue	Stop PDB Residue
1pn0A01	1	79
1pn0A01	110	237
1pn0A01	343	388
1pn0A02	81	107
1pn0A02	238	342
1pn0A02	398	452
1pn0A03	453	661

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.

[top]
Domain ATOM Sequence

>pdb|1pn0A02
STIALYNPDENGHIRRTDRIPDTLPGIEMIGEQTDYIWGVLDAVPASNFPDIRSRCAIHSAESGSIMIIPRENNLVRFYV
QLQATKFTPEVVIANAKKIFHPYTFDVQQLDWFTAYHIGQRVKTYEEERQPFAQALIDFDHQFSRLFSGRPAKDVADEMG
VSMDVFKEAFVKGNEFA

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|1pn0A02
STIALYNPDENGHIRRTDRIPDTLPGIEMIGEQTDYIWGVLDAVPASNFPDIRSRCAIHSAESGSIMIIPRENNLVRFYV
QLQARAEKGGRVDRTKFTPEVVIANAKKIFHPYTFDVQQLDWFTAYHIGQRVKTYEEERQPFAQALIDFDHQFSRLFSGR
PAKDVADEMGVSMDVFKEAFVKGNEFA

BLAST against CATH

[top]
Domain History Events (73)

Domain assigned by lewis on 09 Jan 2007 13:16

Assigning domain 1pn0A02 to 3.30.9.10 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to the old domain 1pn0A03 (from the previous chopping at "Sun Mar 5 17:32:33 2006") which was in 3.30.9.10 at the time the chain was unchopped.

Update comment by auto on 09 Jan 2007 11:45

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 07:39

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 03:39

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 23:43

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 20:17

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 15:38

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 11:40

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 07:33

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 03:34

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 23:27

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 19:31

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 15:44

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 11:45

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 07:35

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 03:47

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 06 Jan 2007 23:42

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 30 Dec 2006 15:28

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 30 Dec 2006 11:30

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 30 Dec 2006 07:31

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 30 Dec 2006 03:30

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 29 Dec 2006 23:26

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 29 Dec 2006 19:29

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 29 Dec 2006 15:28

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 29 Dec 2006 11:31

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 29 Dec 2006 07:30

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 29 Dec 2006 03:31

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 28 Dec 2006 23:25

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 28 Dec 2006 19:29

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 28 Dec 2006 15:29

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 28 Dec 2006 11:27

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 28 Dec 2006 07:30

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 28 Dec 2006 03:33

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 27 Dec 2006 23:25

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 27 Dec 2006 19:29

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 27 Dec 2006 15:30

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 27 Dec 2006 11:31

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 27 Dec 2006 07:31

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 27 Dec 2006 03:32

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 26 Dec 2006 23:25

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 26 Dec 2006 19:32

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 26 Dec 2006 15:30

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 26 Dec 2006 11:27

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 26 Dec 2006 07:34

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 26 Dec 2006 03:34

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 25 Dec 2006 23:28

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 25 Dec 2006 19:32

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 25 Dec 2006 15:30

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 25 Dec 2006 11:30

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 25 Dec 2006 07:32

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 25 Dec 2006 03:32

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 24 Dec 2006 23:34

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 24 Dec 2006 19:31

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 24 Dec 2006 15:33

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 24 Dec 2006 11:27

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 24 Dec 2006 07:31

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 24 Dec 2006 03:31

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 23 Dec 2006 23:35

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 23 Dec 2006 19:30

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 23 Dec 2006 15:29

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 23 Dec 2006 11:29

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 23 Dec 2006 07:31

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 23 Dec 2006 03:35

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 22 Dec 2006 23:33

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 22 Dec 2006 19:35

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 22 Dec 2006 15:44

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 22 Dec 2006 11:42

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Update comment by auto on 22 Dec 2006 07:37

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Flow stage update by auto on 22 Dec 2006 07:36

Domain "1pn0A02" hits Domain "1fohB02" (98.9304812834225% over 100%) which is currently in process

Flow stage update by auto on 22 Dec 2006 07:36

NW result present for Domain "1pn0A02"

Flow stage update by auto on 19 Dec 2006 15:28

All required files are present for Domain "1pn0A02"

Flow stage update by auto on 19 Dec 2006 11:26

Beginning processing for Domain "1pn0A02"

Insertion by auto on 19 Dec 2006 11:19

Final ChopClose added based on similarity with "1pn0B"

University College London - Gower Street - London - WC1E 6BT - Telephone: +44 (0)20 7679 2000 - Copyright © 1999-2008 UCL