CATH Domain: 1pmiA02 XML data for domain: 1pmiA02

Molscript image for 1pmiA02
1pmiA02
PDB coordinates for domain 1pmiA02

PDB 1pmi, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.441 Phosphomannose Isomerase; domain 2
1.10.441.10 Phosphomannose Isomerase, domain 2 Gene3D
1.10.441.10.1
1.10.441.10.1.1
1.10.441.10.1.1.1
1.10.441.10.1.1.1.1
1.10.441.10.1.1.1.1.1

[top]
Segment boundaries for domain 1pmiA02

Chopping figure for domain 1pmiA02
DomainStart PDB ResidueStop PDB Residue
1pmiA01 10 153
1pmiA01 265 305
1pmiA02 154 264
1pmiA02 306 330
1pmiA03 2 9
1pmiA03 331 441

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1pmiA02
PLDQLAKTLATVPELNEIIGQELVDEFISGIKLPAEVGSQDDVNNRKLLQKVFGKLMNTDDDVIKQQTAKLLERTDREPQ
VFKDIDSRLPELIQRLNKQFPNDIGLFCGCLGFTPKFKDVKNLVEMLTYSYESVEK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1pmiA02
PLDQLAKTLATVPELNEIIGQELVDEFISGIKLPAEVGSQDDVNNRKLLQKVFGKLMNTDDDVIKQQTAKLLERTDREPQ
VFKDIDSRLPELIQRLNKQFPNDIGLFCGCLGFTPKFKDVKNLVEMLTYSYESVEK
BLAST against CATH

[top]
Domain History Events (3)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1pmi002" to "1pmiA02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Domain assigned by lewis on 09 Aug 2006 17:12

Automatically fixing a bunch of choppings that have domains with misordered segments. Here the domain is being reassigned back to its original superfamily. This work is done under ticket:98.

Insertion by lewis on 09 Aug 2006 17:12

Automatically fixing a bunch of choppings that have domains with misordered segments. Here the chopping is being reinserted but with the segments reordered in the domains. The domains should not be reordered. This work is done under ticket:98.