CATH Domain: 1plqA00 XML data for domain: 1plqA00

Molscript image for 1plqA00
1plqA00
PDB coordinates for domain 1plqA00

PDB 1plq, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.70 Box
3.70.10 Proliferating Cell Nuclear Antigen
3.70.10.10 Gene3D
3.70.10.10.7
3.70.10.10.7.1
3.70.10.10.7.1.1
3.70.10.10.7.1.1.1
3.70.10.10.7.1.1.1.1

Segment boundaries for domain 1plqA00

Chopping figure for domain 1plqA00
DomainStart PDB ResidueStop PDB Residue
1plqA00 1 258

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.70.10.10.7.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1sxjH02 80.29 DNA replicationProliferating cell nuclear antigenProliferating cell nuclear antigenPCNA complexProtein binding 3.10.150.10 125 96 48 0.81 1.67
1vpkA03 73.50 Thermotoga maritimaPyrimidine metabolismDNA replicationPurine metabolismMetabolic pathways 3.10.150.10 119 12 43 2.15 4.91
3d1gA03 73.14 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 3.10.150.10 119 11 43 2.06 4.70
Displaying entries 1 to 3 (page 1 of 1)


Domain ATOM Sequence

>pdb|1plqA00
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILR
CGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINI
MITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFD
LKSGFLQFFLAPKFNDEE    

Domain COMBS Sequence

>pdb|1plqA00
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILR
CGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINI
MITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFD
LKSGFLQFFLAPKFNDEE    

Domain History Events (20)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1plq000" to "1plqA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Domain assigned by lewis on 09 Jan 2007 13:16

Assigning domain 1plq000 to 3.70.10.10 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to the old domain 1plq000 (from the previous chopping at "Sun Mar 5 15:55:13 2006") which was in 3.70.10.10 at the time the chain was unchopped.

Update comment by auto on 09 Jan 2007 11:43

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 07:37

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 03:38

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 23:41

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 20:16

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 15:36

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 11:38

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 07:32

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 03:32

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 23:26

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 19:31

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 15:41

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 11:43

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Flow stage update by auto on 07 Jan 2007 11:42

Domain "1plq000" hits Domain "1plr000" (100% over 100%) which is currently in process

Flow stage update by auto on 07 Jan 2007 11:42

NW result present for Domain "1plq000"

Flow stage update by auto on 22 Dec 2006 19:34

All required files are present for Domain "1plq000"

Flow stage update by auto on 21 Dec 2006 19:37

Beginning processing for Domain "1plq000"

Insertion by cuff on 21 Dec 2006 17:54

chains to chop