CATH Domain: 1pk3A00 XML data for domain: 1pk3A00

Molscript image for 1pk3A00
1pk3A00
PDB coordinates for domain 1pk3A00

PDB 1pk3, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.50 Transcription Factor, Ets-1 Gene3D
1.10.150.50.2
1.10.150.50.2.1
1.10.150.50.2.1.1
1.10.150.50.2.1.1.1
1.10.150.50.2.1.1.1.1

[top]
Segment boundaries for domain 1pk3A00

Chopping figure for domain 1pk3A00
DomainStart PDB ResidueStop PDB Residue
1pk3A00 5 80

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 1.10.150.50.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1z1vA00 86.07 Protein kinase regulator activitySAM domain bindingProtein STE50Signal transduction involved in filamentous growthPheromone-dependent signal transduction involved in conjugation with cellular fusion 1.10.150.50 70 21 86 2.15 2.48
1x66A01 84.93 Sequence-specific DNA binding transcription factor activityHemostasisOrgan morphogenesisHomo sapiensFriend leukemia integration 1 transcription factor 1.10.150.50 70 21 85 2.60 3.04
3h8mA00 84.05 EphA7 [EC:2.7.10.1]Homo sapiensEphrin type-A receptor 7Axon guidance 1.10.150.50 71 12 84 3.79 4.50
1b4fA00 84.00 Ephrin type-B receptor 2Homo sapiensTransmembrane-ephrin receptor activity 1.10.150.50 74 10 81 2.77 3.40
1x9xA00 83.01 MAPK signaling pathway - yeastSAM domain bindingIdentical protein bindingInvasive growth in response to glucose limitationActivation of MAPKK activity 1.10.150.50 62 16 78 2.21 2.80
3kkaD00 82.97 Integral to plasma membraneEphrin type-A receptor 2Protein bindingSignal transductionEph receptor A2 [EC:2.7.10.1] 1.10.150.50 68 8 82 2.75 3.32
1sv0D00 80.54 ETS-domain lackingNegative regulation of transcriptionRegulation of epidermal growth factor receptor signaling pathwayRegulation of Ras protein signal transductionDrosophila melanogaster 1.10.150.50 81 17 86 3.63 4.20
1sxdA00 79.25 Mus musculusGA-binding protein alpha chainIn utero embryonic developmentNucleusNegative regulation of transcription from RNA polymerase II promoter 1.10.150.50 91 14 70 3.29 4.68
1dxsA00 72.69 DNA damage response, signal transduction resulting in induction of apoptosisTranscription factor bindingProtein bindingPositive regulation of transcription, DNA-dependentMismatch repair 1.10.150.50 57 7 69 3.32 4.76
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1pk3A00
RANSHLRSQPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLRLNSEMMMKYMGLKLGPALKICNLVNKVN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1pk3A00
MEKTRANSHLRSQPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLRLNSEMMMKYMGLKLGPALKICNLVNKVN
GRDHHHHHH
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 29 Nov 2006 21:25

Assigning to "1.10.150.50" based on similarity with "1pk3B00"

Flow stage update by auto on 29 Nov 2006 21:24

No in_process hits for Domain "1pk3A00" ready to be processed

Flow stage update by auto on 29 Nov 2006 21:24

NW result present for Domain "1pk3A00"

Flow stage update by auto on 29 Nov 2006 13:24

All required files are present for Domain "1pk3A00"

Flow stage update by auto on 28 Nov 2006 18:21

Beginning processing for Domain "1pk3A00"

Insertion by auto on 28 Nov 2006 17:28

Final ChopClose added based on similarity with "1pk3C"