CATH Domain: 1pjuA02 XML data for domain: 1pjuA02

Molscript image for 1pjuA02
1pjuA02
PDB coordinates for domain 1pjuA02

PDB 1pju, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.60 Wheat Germ Agglutinin (Isolectin 2); domain 1
3.30.60.30 Gene3D
3.30.60.30.6
3.30.60.30.6.1
3.30.60.30.6.1.1
3.30.60.30.6.1.1.1
3.30.60.30.6.1.1.1.1

[top]
Segment boundaries for domain 1pjuA02

Chopping figure for domain 1pjuA02
DomainStart PDB ResidueStop PDB Residue
1pjuA01 24 86
1pjuA02 2 23
1pjuA02 87 115

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1pjuA02
ACTRECGNLGFGICPRSEGSPLCTTCCTGYKGCYYFGKDGKFVCEGESDEP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1pjuA02
KACTRECGNLGFGICPRSEGSPLCTTCCTGYKGCYYFGKDGKFVCEGESDEP
BLAST against CATH

[top]
Domain History Events (2)

Domain assigned by lewis on 09 Aug 2006 17:12

Automatically fixing a bunch of choppings that have domains with misordered segments. Here the domain is being reassigned back to its original superfamily. This work is done under ticket:98.

Insertion by lewis on 09 Aug 2006 17:12

Automatically fixing a bunch of choppings that have domains with misordered segments. Here the chopping is being reinserted but with the segments reordered in the domains. The domains should not be reordered. This work is done under ticket:98.