CATH Domain: 1pg2A02 XML data for domain: 1pg2A02

Molscript image for 1pg2A02
1pg2A02
PDB coordinates for domain 1pg2A02

PDB 1pg2, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.730 Isoleucyl-tRNA Synthetase; Domain 1
1.10.730.10 Isoleucyl-tRNA Synthetase; Domain 1 Gene3D
1.10.730.10.1
1.10.730.10.1.1
1.10.730.10.1.1.1
1.10.730.10.1.1.1.1
1.10.730.10.1.1.1.1.4

[top]
Segment boundaries for domain 1pg2A02

Chopping figure for domain 1pg2A02
DomainStart PDB ResidueStop PDB Residue
1pg2A01 4 388
1pg2A01 532 550
1pg2A02 389 531

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.730.10.1.1.1.1.4 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rqgA04 86.25 Aminoacyl-tRNA biosynthesisSelenoamino acid metabolismPyrococcus abyssiMethionyl-tRNA synthetaseMethionyl-tRNA synthetase [EC:6.1.1.10] 1.10.730.10 151 27 90 2.33 2.59
2d5bA03 84.67 Aminoacyl-tRNA biosynthesisThermus thermophilus HB8Selenoamino acid metabolismMethionyl-tRNA synthetaseMethionyl-tRNA synthetase [EC:6.1.1.10] 1.10.730.10 164 18 82 2.24 2.72
1wkbA03 81.22 Leucyl-tRNA synthetase [EC:6.1.1.4]Aminoacyl-tRNA biosynthesisPyrococcus horikoshiiLeucyl-tRNA synthetaseValine, leucine and isoleucine biosynthesis 1.10.730.10 121 14 73 2.38 3.22
1qu3A04 80.09 Aminoacyl-tRNA biosynthesisIsoleucyl-tRNA synthetase [EC:6.1.1.5]Isoleucyl-tRNA synthetaseStaphylococcus aureusValine, leucine and isoleucine biosynthesis 1.10.730.10 150 9 80 3.46 4.33
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1pg2A02
VVNLASRNAGFINKRFDGVLASELADPQLYKTFTDAAEVIGEAWESREFGKAVREIMALADLANRYVDEQAPWVVAKQEG
RDADLQAICSMGINLFRVLMTYLKPVLPKLTERAEAFLNTELTWDGIQQPLLGHKVNPFKALY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1pg2A02
VVNLASRNAGFINKRFDGVLASELADPQLYKTFTDAAEVIGEAWESREFGKAVREIMALADLANRYVDEQAPWVVAKQEG
RDADLQAICSMGINLFRVLMTYLKPVLPKLTERAEAFLNTELTWDGIQQPLLGHKVNPFKALY
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 24 Aug 2007 14:15

Assigning to "1.10.730.10" based on similarity with "1f4lA03"

Flow stage update by auto on 24 Aug 2007 14:07

No in_process hits for Domain "1pg2A02" ready to be processed

Flow stage update by auto on 24 Aug 2007 14:07

NW result present for Domain "1pg2A02"

Flow stage update by auto on 22 Aug 2007 10:08

All required files are present for Domain "1pg2A02"

Flow stage update by auto on 21 Aug 2007 17:49

Beginning processing for Domain "1pg2A02"

Insertion by auto on 21 Aug 2007 14:10

Final ChopClose added based on similarity with "1pg0A"