CATH Domain: 1pftA00 XML data for domain: 1pftA00

Molscript image for 1pftA00
1pftA00
PDB coordinates for domain 1pftA00

PDB 1pft, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.25 N-terminal domain of TfIIb
2.20.25.10 Gene3D
2.20.25.10.18
2.20.25.10.18.1
2.20.25.10.18.1.1
2.20.25.10.18.1.1.1
2.20.25.10.18.1.1.1.1

[top]
Segment boundaries for domain 1pftA00

Chopping figure for domain 1pftA00
DomainStart PDB ResidueStop PDB Residue
1pftA00 1 50

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.20.25.10.18.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3cngA01 78.99 NUDIX hydrolaseNitrosomonas europaea 2.20.70.10 34 23 60 2.16 3.60
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1pftA00
MVNKQKVCPACESAELIYDPERGEIVCAKCGYVIEENIIDMGPEWRAFDA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1pftA00
MVNKQKVCPACESAELIYDPERGEIVCAKCGYVIEENIIDMGPEWRAFDA
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1pft000" to "1pftA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:46

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"