CATH Domain: 1parB00 XML data for domain: 1parB00

Molscript image for 1parB00
1parB00
PDB coordinates for domain 1parB00

PDB 1par, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1220 Arc Repressor Mutant
1.10.1220.10 Met repressor-like Gene3D
1.10.1220.10.3
1.10.1220.10.3.1
1.10.1220.10.3.1.1
1.10.1220.10.3.1.1.3
1.10.1220.10.3.1.1.3.7

[top]
Segment boundaries for domain 1parB00

Chopping figure for domain 1parB00
DomainStart PDB ResidueStop PDB Residue
1parB00 1 53

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.1220.10.3.1.1.3.7 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2hzaA01 92.32 CopG family transcriptional regulator, nickel-responsive regulatorNickel-responsive regulatorProtein bindingEscherichia coli K-12 1.10.1220.10 46 10 97 2.13 2.18
1y9bB01 89.14 Vibrio choleraePutative uncharacterized protein 1.10.1220.10 43 27 93 1.92 2.05
1p94A00 80.31 Plasmid partition protein ParGSalmonella enterica subsp. enterica serovar Newport 1.10.1220.10 76 17 56 1.58 2.79
3fmtE01 78.26 Protein seqANegative modulator of initiation of replicationProtein bindingEscherichia coli K-12 1.10.1220.10 41 9 82 3.58 4.33
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1parB00
MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1parB00
MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:38

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"