CATH Domain: 1p7tB04 XML data for domain: 1p7tB04

Molscript image for 1p7tB04
1p7tB04
PDB coordinates for domain 1p7tB04

PDB 1p7t, Chain B, Domain 4

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1220 Malate Synthase G; Chain: A; Domain 4
1.20.1220.12 Gene3D
1.20.1220.12.1
1.20.1220.12.1.1
1.20.1220.12.1.1.1
1.20.1220.12.1.1.1.1
1.20.1220.12.1.1.1.1.1

[top]
Segment boundaries for domain 1p7tB04

Chopping figure for domain 1p7tB04
DomainStart PDB ResidueStop PDB Residue
1p7tB01 8 88
1p7tB02 135 262
1p7tB02 296 333
1p7tB03 89 134
1p7tB03 263 295
1p7tB03 334 588
1p7tB04 589 722

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.20.1220.12.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1n8iA04 92.46 Pyruvate metabolismGlyoxylate and dicarboxylate metabolismMetabolic pathwaysMalate synthase GMalate synthase [EC:2.3.3.9] 1.20.1220.12 108 70 80 0.61 0.76
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1p7tB04
AQEIQQELDNNVQGILGYVVRWVEQGIGSKVPDIHNVALMEDRATLRISSQHIANWLRHGILTKEQVQASLENMAKVVDQ
QNAGDPAYRPMAGNFANSAFKAASDLIFLGVKQPNGYTEPLLHAWRLREKES
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1p7tB04
AQEIQQELDNNVQGILGYVVRWVEQGIGXSKVPDIHNVALMEDRATLRISSQHIANWLRHGILTKEQVQASLENMAKVVD
QQNAGDPAYRPMAGNFANSXAFKAASDLIFLGVKQPNGYTEPLLHAWRLREKESHLEHHHHHH
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:30

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"