Set cath from cathlist by auto on 05 Mar 2006 18:20
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1p7tB01 | 8 | 88 |
| 1p7tB02 | 135 | 262 |
| 1p7tB02 | 296 | 333 |
| 1p7tB03 | 89 | 134 |
| 1p7tB03 | 263 | 295 |
| 1p7tB03 | 334 | 588 |
| 1p7tB04 | 589 | 722 |
There are 1 matching structural neighberhood comparisons for CATH ID 1.20.1220.12.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1n8iA04 | 92.46 | 1.20.1220.12 | 108 | 70 | 80 | 0.61 | 0.76 |
>pdb|1p7tB04 AQEIQQELDNNVQGILGYVVRWVEQGIGSKVPDIHNVALMEDRATLRISSQHIANWLRHGILTKEQVQASLENMAKVVDQ QNAGDPAYRPMAGNFANSAFKAASDLIFLGVKQPNGYTEPLLHAWRLREKES
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"