Set cath from cathlist by auto on 05 Mar 2006 18:49
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1p7tB01 | 8 | 88 |
| 1p7tB02 | 135 | 262 |
| 1p7tB02 | 296 | 333 |
| 1p7tB03 | 89 | 134 |
| 1p7tB03 | 263 | 295 |
| 1p7tB03 | 334 | 588 |
| 1p7tB04 | 589 | 722 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1p7tB02 WGSLYDALYGSDIIPQESGYDPQRGEQVIAWVRRFLDESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVG YRGDAAAPTCILLKNNGLHIELQIDANGRIGKDDPAHINDVIVEGTLQEKMIVRKLNDDRHYTAADGSEISLHGRS
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"