CATH Domain: 1p7tA01 XML data for domain: 1p7tA01

Molscript image for 1p7tA01
1p7tA01
PDB coordinates for domain 1p7tA01

PDB 1p7t, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1860 N-terminal alpha-helical clasp
1.10.1860.10 N-terminal alpha-helical clasp Gene3D
1.10.1860.10.1
1.10.1860.10.1.1
1.10.1860.10.1.1.1
1.10.1860.10.1.1.1.1
1.10.1860.10.1.1.1.1.1

[top]
Segment boundaries for domain 1p7tA01

Chopping figure for domain 1p7tA01
DomainStart PDB ResidueStop PDB Residue
1p7tA01 4 88
1p7tA02 135 262
1p7tA02 296 333
1p7tA03 89 134
1p7tA03 263 295
1p7tA03 334 588
1p7tA04 589 722

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1p7tA01
TITQSRLRIDANFKRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPVKDKAAYKS
FLREL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1p7tA01
MAQTITQSRLRIDANFKRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPVKDKAA
YKSFLREL
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:22

Assigning to "1.10.1860.10" based on similarity with "1p7tB01" (NWSI: 100, NWO: 100, SPS: 94.86, SPO: 95, RMSD: 0.32)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1p7tA01"

Flow stage update by auto on 28 Apr 2006 17:43

All required files are present for Domain "1p7tA01"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1p7tA01"

Insertion by auto on 05 Mar 2006 17:30

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"