Set cath from cathlist by auto on 05 Mar 2006 19:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1p77A01 | 1 | 114 |
| 1p77A01 | 238 | 272 |
| 1p77A02 | 115 | 237 |
There are 3 matching structural neighberhood comparisons for CATH ID 3.40.192.10.5.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2hk9A01 | 89.95 | 3.40.192.10 | 139 | 29 | 89 | 1.38 | 1.53 | |
![]() |
1vi2A01 | 86.58 | 3.40.192.10 | 127 | 31 | 83 | 1.90 | 2.26 | |
![]() |
1npyA01 | 81.98 | 3.40.192.10 | 100 | 22 | 63 | 1.37 | 2.15 |
>pdb|1p77A01 MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAK LAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"