CATH Domain: 1p71B00 XML data for domain: 1p71B00

Molscript image for 1p71B00
1p71B00
PDB coordinates for domain 1p71B00

PDB 1p71, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.520 HU Protein; Chain A
4.10.520.10 HU Protein, subunit A Gene3D
4.10.520.10.1
4.10.520.10.1.1
4.10.520.10.1.1.1
4.10.520.10.1.1.1.1
4.10.520.10.1.1.1.1.1

[top]
Segment boundaries for domain 1p71B00

Chopping figure for domain 1p71B00
DomainStart PDB ResidueStop PDB Residue
1p71B00 1 93

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 4.10.520.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1owfB00 90.65 TranscriptionTranscription activator activityTranscription repressor activityIntegration host factor subunit betaIntegration host factor subunit beta 4.10.520.10 94 32 98 1.80 1.82
2np2A00 89.41 Borrelia burgdorferiIntegration host factor subunit betaHbb 4.10.520.10 102 32 91 2.00 2.19
1owfA00 88.90 Integration host factor subunit alphaTranscriptionIntegration host factor subunit alphaTranscription activator activityTranscription repressor activity 4.10.520.10 96 33 96 2.70 2.79
1exeA00 80.83 Transcription factor 1Bacillus phage SPO1 4.10.520.10 99 32 93 3.27 3.48
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1p71B00
MNKGELVDAVAEKASVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSFESRERKAREGRNPKTNEKMEIPATRVPAFS
AGKLFREKVAPPK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1p71B00
MNKGELVDAVAEKASVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSFESRERKAREGRNPKTNEKMEIPATRVPAFS
AGKLFREKVAPPKA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"