Set cath from cathlist by auto on 05 Mar 2006 19:03
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1p5dX01 | 9 | 154 |
| 1p5dX02 | 174 | 251 |
| 1p5dX03 | 252 | 370 |
| 1p5dX04 | 371 | 463 |
There are 5 matching structural neighberhood comparisons for CATH ID 3.30.310.50.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2fuvA04 | 83.13 | 3.30.310.50 | 100 | 17 | 85 | 3.35 | 3.94 | |
![]() |
1tuoA04 | 80.72 | 3.30.310.50 | 65 | 23 | 62 | 1.95 | 3.13 | |
![]() |
1kfiA04 | 78.09 | 3.30.310.50 | 125 | 15 | 70 | 3.10 | 4.40 | |
![]() |
2pgcA01 | 75.68 | 3.30.70.900 | 95 | 9 | 83 | 3.95 | 4.75 | |
![]() |
1lq9A00 | 73.65 | 3.30.70.900 | 112 | 11 | 73 | 3.59 | 4.90 |
>pdb|1p5dX04 ISTPEINITVTEDSKFAIIEALQRDAQWGEGNITTLDGVRVDYPKGWGLVRASNTTPVLVLRFEADTEEELERIKTVFRN QLKAVDSSLPVPF
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"