Set cath from cathlist by auto on 05 Mar 2006 19:24
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1p5dX01 | 9 | 154 |
| 1p5dX02 | 174 | 251 |
| 1p5dX03 | 252 | 370 |
| 1p5dX04 | 371 | 463 |
There are 4 matching structural neighberhood comparisons for CATH ID 3.40.120.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1tuoA03 | 89.45 | 3.40.120.10 | 117 | 20 | 95 | 2.42 | 2.53 | |
![]() |
1kfiA03 | 85.61 | 3.40.120.10 | 126 | 15 | 87 | 1.98 | 2.27 | |
![]() |
3pmgA03 | 84.46 | 3.40.120.10 | 100 | 15 | 79 | 2.35 | 2.94 | |
![]() |
1p5dX02 | 73.48 | 3.40.120.10 | 78 | 11 | 44 | 2.16 | 4.85 |
>pdb|1p5dX03 TNTGTIIYPDRLLMLFAKDVVSRNPGADIIFDVKCTRRLIALISGYGGRPVMWKTGHSLIKKKMKETGALLAGEMSGHVF FKERWFGFDDGIYSAARLLEILSQDQRDSEHVFSAFPSD
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"