CATH Domain: 1p5dX02 XML data for domain: 1p5dX02

Molscript image for 1p5dX02
1p5dX02
PDB coordinates for domain 1p5dX02

PDB 1p5d, Chain X, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.120 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3
3.40.120.10 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 Gene3D
3.40.120.10.8
3.40.120.10.8.1
3.40.120.10.8.1.1
3.40.120.10.8.1.1.1
3.40.120.10.8.1.1.1.1

[top]
Segment boundaries for domain 1p5dX02

Chopping figure for domain 1p5dX02
DomainStart PDB ResidueStop PDB Residue
1p5dX01 9 154
1p5dX02 174 251
1p5dX03 252 370
1p5dX04 371 463

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.120.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2fuvA02 84.38 Galactose metabolismAmino sugar and nucleotide sugar metabolismMetabolic pathwaysStarch and sucrose metabolismPentose phosphate pathway 3.40.120.10 92 25 81 1.92 2.36
1kfiA02 82.63 Galactose metabolismAmino sugar and nucleotide sugar metabolismPhosphoglucomutase-1Metabolic pathwaysStarch and sucrose metabolism 3.40.120.10 109 33 70 2.78 3.94
1dv1B01 78.94 Pyruvate metabolismFatty acid biosynthesisPropanoate metabolismMetabolic pathwaysFatty acid biosynthetic process 3.40.50.20 85 12 75 3.75 4.98
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1p5dX02
KVVVDCGNGVAGVIAPQLIEALGCSVIPLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGLAFDGDGDRVGVV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1p5dX02
KVVVDCGNGVAGVIAPQLIEALGCSVIPLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGLAFDGDGDRVGVV
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:24

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:24

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"