Set cath from cathlist by auto on 05 Mar 2006 19:24
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1p5dX01 | 9 | 154 |
| 1p5dX02 | 174 | 251 |
| 1p5dX03 | 252 | 370 |
| 1p5dX04 | 371 | 463 |
There are 4 matching structural neighberhood comparisons for CATH ID 3.40.120.10.2.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1wqaA01 | 90.58 | 3.40.120.10 | 152 | 36 | 94 | 1.91 | 2.02 | |
![]() |
1tuoA01 | 88.77 | 3.40.120.10 | 148 | 31 | 97 | 2.89 | 2.97 | |
![]() |
2fuvA01 | 81.74 | 3.40.120.10 | 204 | 24 | 71 | 2.72 | 3.83 | |
![]() |
3pmgA01 | 79.95 | 3.40.120.10 | 196 | 19 | 73 | 2.91 | 3.96 |
>pdb|1p5dX01 LPASIFRAYDIRGVVGDTLTAETAYWIGRAIGSESLARGEPCVAVGRDGRLSGPELVKQLIQGLVDCGCQVSDVGMVPTP VLYYAANVLEGKSGVMLTGHNPPDYNGFKIVVAGETLANEQIQALRERIEKNDLASGVGSVEQVD
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"