CATH Domain: 1p3qQ00 XML data for domain: 1p3qQ00

Molscript image for 1p3qQ00
1p3qQ00
PDB coordinates for domain 1p3qQ00

PDB 1p3q, Chain Q, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.8 Helicase, Ruva Protein; domain 3
1.10.8.10 DNA helicase RuvA subunit, C-terminal domain Gene3D
1.10.8.10.6
1.10.8.10.6.1
1.10.8.10.6.1.1
1.10.8.10.6.1.1.1
1.10.8.10.6.1.1.1.1

[top]
Segment boundaries for domain 1p3qQ00

Chopping figure for domain 1p3qQ00
DomainStart PDB ResidueStop PDB Residue
1p3qQ00 398 444

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.10.8.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2izxB00 81.92 CAMP-dependent protein kinase type II-alpha regulatory subunitMembrane fractionApoptosisInsulin signaling pathwayPlasma membrane 1.20.890.10 41 4 81 2.84 3.49
1tfeA02 80.51 Thermus thermophilus HB8Elongation factor EF-TsElongation factor Ts 1.10.286.20 45 11 86 3.62 4.18
2hwnB00 80.31 Protein domain specific bindingRattus norvegicusRegulation of protein kinase activityProtein homodimerization activityInsulin signaling pathway 1.20.890.10 45 6 84 4.13 4.89
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1p3qQ00
SSLIKKIEENERKDTLNTLQNFPDDPSLIEDVCIAAASGPCVD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1p3qQ00
SSLIKKIEENERKDTLNTLQNXFPDXDPSLIEDVCIAAASRIGPCVDALLSLSE
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:22

Assigning to "1.10.8.10" based on similarity with "1mn3A00" (NWSI: 90.7407407407407, NWO: 100, SPS: 84.04, SPO: 82, RMSD: 5.19)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1p3qQ00"

Flow stage update by auto on 28 Apr 2006 17:43

All required files are present for Domain "1p3qQ00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1p3qQ00"

Insertion by auto on 05 Mar 2006 16:04

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"