CATH Domain: 1ozhD01 XML data for domain: 1ozhD01

Molscript image for 1ozhD01
1ozhD01
PDB coordinates for domain 1ozhD01

PDB 1ozh, Chain D, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.970 Gene3D
3.40.50.970.20
3.40.50.970.20.1
3.40.50.970.20.1.1
3.40.50.970.20.1.1.1
3.40.50.970.20.1.1.1.1

[top]
Segment boundaries for domain 1ozhD01

Chopping figure for domain 1ozhD01
DomainStart PDB ResidueStop PDB Residue
1ozhD01 7 188
1ozhD02 189 360
1ozhD03 366 555

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.970.20.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1t9bB01 92.27 Acetolactate synthase I/II/III large subunit [EC:2.2.1.6]Metabolic pathwaysValine, leucine and isoleucine biosynthesisButanoate metabolismFlavin adenine dinucleotide binding 3.40.50.970 185 32 92 1.61 1.74
1yd7A00 84.69 Pyrococcus furiosus2-oxoglutarate ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3]Citrate cycle (TCA cycle)2-keto acid:ferredoxin oxidoreductase subunit alphaMetabolic pathways 3.40.50.970 162 13 84 2.48 2.95
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ozhD01
VRQWAHGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSIRIIPVRHEANAAFMAAAVGRITGKAGVALVTSGPGCS
NLITGMATANSEGDPVVALGGAVKRADKSMDTVAMFSPVTKYAIEVTAPDALAEVVSNAFRAAEQGRPGSAFVSLPQDVV
DGPVSGKVLPASGAPQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ozhD01
MDKQYPVRQWAHGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSIRIIPVRHEANAAFMAAAVGRITGKAGVALVT
SGPGCSNLITGMATANSEGDPVVALGGAVKRADKAKQVHQSMDTVAMFSPVTKYAIEVTAPDALAEVVSNAFRAAEQGRP
GSAFVSLPQDVVDGPVSGKVLPASGAPQ
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 08 Jan 2007 03:36

Assigning to "3.40.50.970" based on similarity with "1ozfA01"

Flow stage update by auto on 08 Jan 2007 03:33

No in_process hits for Domain "1ozhD01" ready to be processed

Update comment by auto on 07 Jan 2007 23:27

Domain "1ozhD01" hits Domain "1ozhB01" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 19:31

Domain "1ozhD01" hits Domain "1ozfA01" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 15:44

Domain "1ozhD01" hits Domain "1ozfB01" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 11:45

Domain "1ozhD01" hits Domain "1ozgB01" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 07:35

Domain "1ozhD01" hits Domain "1ozgA01" (100% over 100%) which is currently in process

Flow stage update by auto on 07 Jan 2007 07:34

Domain "1ozhD01" hits Domain "1ozgA01" (100% over 100%) which is currently in process

Flow stage update by auto on 07 Jan 2007 07:34

NW result present for Domain "1ozhD01"

Flow stage update by auto on 22 Dec 2006 19:34

All required files are present for Domain "1ozhD01"

Flow stage update by auto on 21 Dec 2006 23:35

Beginning processing for Domain "1ozhD01"

Insertion by auto on 21 Dec 2006 23:24

Final ChopClose added based on similarity with "1ozgA"