CATH Domain: 1ozhB03 XML data for domain: 1ozhB03

Molscript image for 1ozhB03
1ozhB03
PDB coordinates for domain 1ozhB03

PDB 1ozh, Chain B, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.970 Gene3D
3.40.50.970.17
3.40.50.970.17.1
3.40.50.970.17.1.1
3.40.50.970.17.1.1.1
3.40.50.970.17.1.1.1.1

[top]
Segment boundaries for domain 1ozhB03

Chopping figure for domain 1ozhB03
DomainStart PDB ResidueStop PDB Residue
1ozhB01 7 188
1ozhB02 189 363
1ozhB03 364 559

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.970.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ybhA03 88.05 ChloroplastAcetolactate synthase I/II/III large subunit [EC:2.2.1.6]Acetolactate synthase, chloroplasticValine, leucine and isoleucine biosynthesisMetabolic pathways 3.40.50.970 194 21 93 2.17 2.31
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ozhB03
AQLNQFALHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYTFRARQVMISNGQQTMGVALPWAIGAWLVNPERKVVS
VSGDGGFLQSSMELETAVRLKANVLHLIWVDNGYNMVAIQEEKKYQRLSGVEFGPMDFKAYAESFGAKGFAVESAEALEP
TLRAAMDVDGPAVVAIPVDYRDNPLLMGQLHLSQIL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ozhB03
AQLNQFALHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYTFRARQVMISNGQQTMGVALPWAIGAWLVNPERKVVS
VSGDGGFLQSSMELETAVRLKANVLHLIWVDNGYNMVAIQEEKKYQRLSGVEFGPMDFKAYAESFGAKGFAVESAEALEP
TLRAAMDVDGPAVVAIPVDYRDNPLLMGQLHLSQILEHHHHHH
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 07 Jan 2007 23:29

Assigning to "3.40.50.970" based on similarity with "1ozhC03"

Flow stage update by auto on 07 Jan 2007 23:27

No in_process hits for Domain "1ozhB03" ready to be processed

Update comment by auto on 07 Jan 2007 19:31

Domain "1ozhB03" hits Domain "1ozfA03" (100% over 99.5098039215686%) which is currently in process

Update comment by auto on 07 Jan 2007 15:44

Domain "1ozhB03" hits Domain "1ozfB03" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 11:45

Domain "1ozhB03" hits Domain "1ozgB03" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 07:35

Domain "1ozhB03" hits Domain "1ozgA03" (100% over 100%) which is currently in process

Flow stage update by auto on 07 Jan 2007 07:34

Domain "1ozhB03" hits Domain "1ozgA03" (100% over 100%) which is currently in process

Flow stage update by auto on 07 Jan 2007 07:34

NW result present for Domain "1ozhB03"

Flow stage update by auto on 22 Dec 2006 19:34

All required files are present for Domain "1ozhB03"

Flow stage update by auto on 22 Dec 2006 03:40

Beginning processing for Domain "1ozhB03"

Insertion by auto on 22 Dec 2006 03:29

Final ChopClose added based on similarity with "1ozgA"