CATH Domain: 1oxjA01 XML data for domain: 1oxjA01

Molscript image for 1oxjA01
1oxjA01
PDB coordinates for domain 1oxjA01

PDB 1oxj, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.50 Transcription Factor, Ets-1 Gene3D
1.10.150.50.5
1.10.150.50.5.1
1.10.150.50.5.1.1
1.10.150.50.5.1.1.1
1.10.150.50.5.1.1.1.1

[top]
Segment boundaries for domain 1oxjA01

Chopping figure for domain 1oxjA01
DomainStart PDB ResidueStop PDB Residue
1oxjA01 594 654
1oxjA02 655 763

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 1.10.150.50.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1dxsA00 88.29 DNA damage response, signal transduction resulting in induction of apoptosisTranscription factor bindingProtein bindingPositive regulation of transcription, DNA-dependentMismatch repair 1.10.150.50 57 14 88 1.54 1.74
1x9xA00 86.67 MAPK signaling pathway - yeastSAM domain bindingIdentical protein bindingInvasive growth in response to glucose limitationActivation of MAPKK activity 1.10.150.50 62 21 91 2.29 2.49
3kkaD00 86.19 Integral to plasma membraneEphrin type-A receptor 2Protein bindingSignal transductionEph receptor A2 [EC:2.7.10.1] 1.10.150.50 68 26 88 3.54 4.01
1z1vA00 84.09 Protein kinase regulator activitySAM domain bindingProtein STE50Signal transduction involved in filamentous growthPheromone-dependent signal transduction involved in conjugation with cellular fusion 1.10.150.50 70 9 87 2.98 3.42
1x66A01 83.59 Sequence-specific DNA binding transcription factor activityHemostasisOrgan morphogenesisHomo sapiensFriend leukemia integration 1 transcription factor 1.10.150.50 70 18 82 2.87 3.46
1v38A00 82.93 Mus musculusSAM domain-containing protein SAMSN-1 1.10.150.50 78 16 75 3.36 4.44
1sv0D00 75.92 ETS-domain lackingNegative regulation of transcriptionRegulation of epidermal growth factor receptor signaling pathwayRegulation of Ras protein signal transductionDrosophila melanogaster 1.10.150.50 81 8 71 3.01 4.20
1in0A01 75.41 Hypothetical proteinHaemophilus influenzaeUPF0234 protein HI_1034 3.30.70.860 70 6 70 3.48 4.97
1kl9A02 75.11 Translation initiation factor activityTranslation initiation factor eIF-2 alpha subunitEukaryotic translation initiation factor 2 subunit 1PolysomeHomo sapiens 1.10.150.190 92 11 64 3.05 4.76
2fj6A01 70.56 UPF0346 protein yozEBacillus subtilis 1.10.150.260 72 6 75 3.57 4.76
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1oxjA01
HMVGMSGIGLWLKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGVTKGASHKLALCIDKLK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1oxjA01
GTHMVGMSGIGLWLKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGVTKGASHKLALCIDKLK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:28

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"