CATH Domain: 1owfA00 XML data for domain: 1owfA00

Molscript image for 1owfA00
1owfA00
PDB coordinates for domain 1owfA00

PDB 1owf, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.520 HU Protein; Chain A
4.10.520.10 HU Protein, subunit A Gene3D
4.10.520.10.3
4.10.520.10.3.1
4.10.520.10.3.1.1
4.10.520.10.3.1.1.1
4.10.520.10.3.1.1.1.1

[top]
Segment boundaries for domain 1owfA00

Chopping figure for domain 1owfA00
DomainStart PDB ResidueStop PDB Residue
1owfA00 2 97

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 4.10.520.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2np2A00 87.44 Borrelia burgdorferiIntegration host factor subunit betaHbb 4.10.520.10 102 30 92 1.51 1.64
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1owfA00
ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTF
RPGQKLKSRVENASPK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1owfA00
MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVT
FRPGQKLKSRVENASPKDE
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"