CATH Domain: 1ornA01 XML data for domain: 1ornA01

Molscript image for 1ornA01
1ornA01
PDB coordinates for domain 1ornA01

PDB 1orn, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.340 Endonuclease III; domain 1
1.10.340.30 Hypothetical protein; domain 2 Gene3D
1.10.340.30.6
1.10.340.30.6.1
1.10.340.30.6.1.1
1.10.340.30.6.1.1.1
1.10.340.30.6.1.1.1.1

[top]
Segment boundaries for domain 1ornA01

Chopping figure for domain 1ornA01
DomainStart PDB ResidueStop PDB Residue
1ornA01 22 133
1ornA02 2 21
1ornA02 134 213

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.340.30.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1keaA02 92.64 G/T mismatches repair enzymeMethanothermobacter thermautotrophicus 1.10.340.30 113 33 97 1.46 1.50
1ngnA00 83.85 DNA damage response, signal transduction resulting in induction of apoptosisDNA methylationNucleusChromatinMus musculus 1.10.340.30 144 18 72 2.10 2.88
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ornA01
HCELVHRNPFELLIAVVLSAQCTDALVNKVTKRLFEKYRTPHDYIAVPLEELEQDIRSIGLYRNKARNIQKLCAMLIDKY
NGEVPRDRDELMKLPGVGRKTANVVVSVAFGV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ornA01
HCELVHRNPFELLIAVVLSAQCTDALVNKVTKRLFEKYRTPHDYIAVPLEELEQDIRSIGLYRNKARNIQKLCAMLIDKY
NGEVPRDRDELMKLPGVGRKTANVVVSVAFGV
BLAST against CATH

[top]
Domain History Events (5)

Classification merge by cuff on 25 Apr 2006 18:16

COMMENT: Mark - Clearly a homology missed during Homcheck FINAL: Lesley - Yes, clearly related. Mark, why were these not picked up during homolcheck???Lesley - Conservatively, Merge 10 into 30 for now, until better HMM hits allow us to clearly bring it into 10. They have strong functional correlations but the HMM hits are no present to any previously existing members of 10. Only a new one going into 10 and that call now being reconsidered in light of these X-hits.

Flow stage update by cuff on 25 Apr 2006 18:16

COMMENT: Mark - Clearly a homology missed during Homcheck FINAL: Lesley - Yes, clearly related. Mark, why were these not picked up during homolcheck???Lesley - Conservatively, Merge 10 into 30 for now, until better HMM hits allow us to clearly bring it into 10. They have strong functional correlations but the HMM hits are no present to any previously existing members of 10. Only a new one going into 10 and that call now being reconsidered in light of these X-hits.

Set cath from cathlist by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:28

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"