CATH Domain: 1or5A00 XML data for domain: 1or5A00

Molscript image for 1or5A00
1or5A00
PDB coordinates for domain 1or5A00

PDB 1or5, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1200 Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A
1.10.1200.10 Gene3D
1.10.1200.10.4
1.10.1200.10.4.1
1.10.1200.10.4.1.1
1.10.1200.10.4.1.1.1
1.10.1200.10.4.1.1.1.1

[top]
Segment boundaries for domain 1or5A00

Chopping figure for domain 1or5A00
DomainStart PDB ResidueStop PDB Residue
1or5A00 1 82

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 1.10.1200.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1dnyA00 84.41 Brevibacillus parabrevisTyrocidine synthase 3 1.10.1200.10 76 18 87 2.69 3.06
2cnrA00 81.76 Acyl carrier proteinAcyl carrier proteinStreptomyces coelicolor 1.10.1200.10 82 23 92 2.97 3.20
2avaA00 80.27 Spinacia oleraceaAcyl carrier protein 1, chloroplastic 1.10.1200.10 82 20 97 3.97 4.07
2jq4A00 80.26 Agrobacterium tumefaciens str. C58Acyl carrier protein, putative 1.10.1200.10 83 14 90 3.21 3.55
1l8qA02 74.67 Two-component systemChromosomal replication initiator proteinChromosomal replication initiator protein dnaAAquifex aeolicus 1.10.8.60 49 8 54 2.57 4.68
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1or5A00
SALTVDDLKKLLAETAGEDDSVDLAGELDTPFVDLGYDSLALLETAAVLQQRYGIALTDETVGRLGTPRELLDEVNTTPA
TA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1or5A00
MSALTVDDLKKLLAETAGEDDSVDLAGELDTPFVDLGYDSLALLETAAVLQQRYGIALTDETVGRLGTPRELLDEVNTTP
ATA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:38

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"