CATH Domain: 1oqjA00 XML data for domain: 1oqjA00

Molscript image for 1oqjA00
1oqjA00
PDB coordinates for domain 1oqjA00

PDB 1oqj, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.390 SAND domain
3.10.390.10 SAND domain Gene3D
3.10.390.10.1
3.10.390.10.1.1
3.10.390.10.1.1.1
3.10.390.10.1.1.1.1
3.10.390.10.1.1.1.1.1

[top]
Segment boundaries for domain 1oqjA00

Chopping figure for domain 1oqjA00
DomainStart PDB ResidueStop PDB Residue
1oqjA00 90 179

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.10.390.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ufnA00 86.50 Mus musculusInduction of apoptosisResponse to bacteriumSp110 nuclear body protein 3.10.390.10 94 26 87 2.87 3.29
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1oqjA00
DMEIAYPITCGESKAILLWKKFVCPGINVKCVKFNDQLISPKHFVHLAGKSTLKDWKRAIRLGGIMLRKMMDSGQIDFYQ
HDKVCSNTCR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1oqjA00
GAMEDMEIAYPITCGESKAILLWKKFVCPGINVKCVKFNDQLISPKHFVHLAGKSTLKDWKRAIRLGGIMLRKMMDSGQI
DFYQHDKVCSNTCRSTK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:52

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:52

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:16

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"