Set cath from cathlist by auto on 05 Mar 2006 19:02
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1opjA01 | 243 | 336 |
| 1opjA02 | 337 | 516 |
There are 46 matching structural neighberhood comparisons for CATH ID 3.30.200.20.15.1.1.1.1 (SIMAX score < 5)
>pdb|1opjA01 AMDPSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLG VCTREPPFYIITEF
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"