CATH Domain: 1ooyA02 XML data for domain: 1ooyA02

Molscript image for 1ooyA02
1ooyA02
PDB coordinates for domain 1ooyA02

PDB 1ooy, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.810 Glutaconate Coenzyme A-transferase; Chain B
3.40.810.20 Glutaconate Coenzyme A-transferase; Chain B Gene3D
3.40.810.20.1
3.40.810.20.1.1
3.40.810.20.1.1.1
3.40.810.20.1.1.1.1
3.40.810.20.1.1.1.1.1

[top]
Segment boundaries for domain 1ooyA02

Chopping figure for domain 1ooyA02
DomainStart PDB ResidueStop PDB Residue
1ooyA01 1 233
1ooyA02 261 474

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.810.20.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1poiB00 80.22 Butanoate metabolismGlutaconate CoA-transferase, subunit B [EC:2.8.3.12]Glutaconate CoA-transferase subunit BAcidaminococcus fermentans DSM 20731Styrene degradation 3.40.810.20 260 16 76 2.94 3.82
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ooyA02
NVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNMTVHLQSENGILGLGPYPLQNEVDADLINAGKETVTVLPGASY
FSSDESFAMIRGGHVNLTMLGAMQVSKYGDLANWMIPGKLVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLP
LTGKQCVNRIITEKAVFDVDRKKGLTLIELWEGLTVDDIKKSTGCDFAVSPKLI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ooyA02
NVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNMTVHLQSENGILGLGPYPLQNEVDADLINAGKETVTVLPGASY
FSSDESFAMIRGGHVNLTMLGAMQVSKYGDLANWMIPGKLVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLP
LTGKQCVNRIITEKAVFDVDRKKGLTLIELWEGLTVDDIKKSTGCDFAVSPKLI
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:19

Assigning to "3.40.810.20" based on similarity with "1o9lA02" (NWSI: 100, NWO: 100, SPS: 96.35, SPO: 100, RMSD: 0.73)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1ooyA02"

Flow stage update by auto on 28 Apr 2006 17:43

All required files are present for Domain "1ooyA02"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1ooyA02"

Insertion by auto on 05 Mar 2006 17:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"